Bank jobs in tamil nadu state India
1,804 bank jobs found in tamil nadu state: showing 1 - 50
Relationship Manager
Company: Equitas Small Finance Bank |
-channel leads will also be given to the BDO for conversion. Purpose of the role To acquire New To Bank liability... relationships (Saving Accounts / Deposits) and strengthen existing relationships through highest levels of service quality BankLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
from application to final approval and disbursement. Team Coordination: You act as the bridge between the customer and internal bank...: You ensure all submitted documents are real and valid to protect the bank from losing money. [ , , ]Location: Vellakoil, Tamil Nadu - Erode, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Sh - Accounts Payable, Audit & Consolidation
Company: Aditya Birla Group |
outflow and prepare DFR To transfer funds based on requirement for payment and investment To prepare bank limits Vs... utilization on daily basis To open Letter of Credit & Bank Guarantee based on requirement from units. To prepare investmentLocation: Gummidipoondi, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Record To Report Ops Senior Analyst
Company: Accenture |
asset","Amortization","Depreciation",Accruals","Finacial Consolidation","Account recon/ bank","Treasury","FinanacialLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: DHFGWYETREWQYUWDHSAGDYWAGYDQWHDSDGYSAWGDYWAGDYWGASDYWGDYSAVDHGSAYDGWQYDGQWYUGQWYWDQWWQWSADEWDWDWDWQQEEQWESDLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Solution Architect- Payments Domain
Company: Diverse Lynx |
flows knowledge and implementation experience of Swift Mandates, ISO 20022 Migration, Central bank mandates across majorLocation: Hyderabad, Telangana - Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Area Sales Manager-personal Loan-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's DegreeLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Analyst, Data Strategy
Company: Standard Chartered |
to productionise in collaboration with various teams People & Talent Lead through example and demonstrate the bank's culture... and business conduct, across Standard Chartered Bank. This includes understanding and ensuring compliance with, in letterLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager-commercial Vehicle-marketing Branches Operations
Company: Kotak Mahindra Bank |
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a service... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. EnhanceLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Business Development Officer - Ucv
Company: Equitas Small Finance Bank |
Job Description: Develop consistent pipeline of applications from good quality customers who require finance for purchase of New Commercial Vehicles through direct sourcing, Dealers, market referencLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Circle Manager - Hdfc Bank Branch Banking
Company: Tata AIA Life Insurance |
Job Description: Job description About Company: Tata AIA Life Insurance Company Limited (Tata AIA Life) is a joint venture company, formed by Tata Sons Pvt. Ltd. and AIA Group Ltd. (AIA). Tata ALocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Assistant Manager - Coding Auditor
Company: EXL Service |
. For more information, visit . EXL never requires or asks for fees/payments or credit card or bank details during any phase of theLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager-agri-fin-tractor Loans And Retail(tfe)-retail Sales
Company: Kotak Mahindra Bank |
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are seeking a dynamic and resultsLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Rb-ls: Business Development Associate
Company: Axis Bank |
and retail forex business for the bank. The department drives business from branches across India and is responsible... to increase the retail book of the bank. About the Role Officer Sales are a part of the Bank's front-line sales forceLocation: Thanjavur, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Branch:teller
Company: Axis Bank |
Job Description: About Branch Banking: The branches act as the face of Axis Bank for millions of retail customers... and is, hence, an integral part of the Bank’s strategy. Branches play a major role in deposit mobilization from New-To-Bank (NTBLocation: Thiruverumbur, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Portfolio Relationship Manager - Wc-salaried Pl And Working Capital-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: Needs to have a good knowledgeLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
from application to final approval and disbursement. Team Coordination: You act as the bridge between the customer and internal bank...: You ensure all submitted documents are real and valid to protect the bank from losing money. [ , , ]Location: Vellakoil, Tamil Nadu - Erode, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager-comm Bankg-dealer Business Group-business Development
Company: Kotak Mahindra Bank |
Job Category: Commercial Bank Degree Level: Bachelor's DegreeLocation: Salem, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: adghweudgweydguyweduewydywegfdyuwegfuywgfuyewufgweyfgcuhdgfuyewgdedhgsdycgeydehdcyuedgfyefycygedquwhduhasgdysadu8sahdusgaydwydgwsydsdLocation: Erode, Tamil Nadu - Salem, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Senior Executive – Ar Specialty
Company: EXL Service |
or bank details during any phase of the recruitment or hiring process and has not authorized any agencies or partnersLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL SalesLocation: Sankari, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Sap Ihc Functional Consultant
Company: Ford |
: In-House Cash Accounts Payment advice processing Bank clearing and reconciliation Intercompany settlements Integrate IHC... and IHC (In-House Cash) configuration Good functional understanding of: Payment Orders & Internal Payments House BankLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Manager - Lec Controllers
Company: Standard Chartered |
. Ensure that the periodic reconciliation & substantiation exercise across the bank is performed smoothly and escalate... are in place and being adhered to & to ensure a robust financial control environment in the Bank. Embed the ControllershipLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: fdfhjlkjhgfdsfghjkl;kjhgfdertyuiop;'l,mnbvcxzsdrtyuiopl;,mnbvcxzdstryuiop;'lkmjnbvcxzsaertyuiop[l;kjhgfcdxsawertyuiopl;kmnbvcxzsaertyuiopl;kjmnbvcxsdtfyguhjiklLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: DGFAYTDQWETYDFWEYTDFWEYDFYSCVGSFDTYWEFDTYDHGSTYDEWYTDSGHDYSADYEWDHGYDTCEYDGEHGDYEGDYEFGDHDASJHIDYEWY7DEWYHDELocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager-saral Loans-marketing Branches Operations
Company: Kotak Mahindra Bank |
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a customer... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. EnhanceLocation: Sankari, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Elite Banker-household-outbound-branch Banking-relationship Management
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: We are seeking a dynamic... service while ensuring adherence to bank policies and compliance standards. Cross-sell a wide range of banking productsLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |
Job Description: adfbeshgfweyfdsjcdhfchakxbzhckjachdxzxcjnxcbkjxzncjdshudsczbcududchdgyedyshsdeysusd7gdydgyedtydgyfteywgdswLocation: Tiruppur, Tamil Nadu - Perundurai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Mf Collections
Company: Equitas Small Finance Bank |
Job Description: sfdeufgsuydfgsuydfguydfhdbcydsgfyugfhfh cyugveuyffhbvuydfgfuydvhbcxvuygsduyfghvhcgvyxcbjcngzduyeaucxbuhdgfydcb hfguyffdLocation: Chidambaram, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Assistant Manager - Coding Auditor
Company: EXL Service |
requires or asks for fees/payments or credit card or bank details during any phase of the recruitment or hiring processLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Senior Executive - Coding Auditor
Company: EXL Service |
or bank details during any phase of the recruitment or hiring process and has not authorized any agencies or partnersLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Officer-811-digital Banking Kotak 811-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Relationship Officer for Kotak..., and expanding the bank's digital footprint. Responsibilities: Conduct 100% field-based customer acquisition for SavingsLocation: Salem, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Transformation Manger_culture & Capability, Director
Company: NatWest Group |
bank’s strategic ambitions, shaping One Bank Capabilities (OBC) and customer and colleague journeys You’ll developLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: SDFHSHDFGUEUQWIEOIWQWOPQIPOWIDVFFDHGFHFGHJGJHGJHYJHGJGFDFAEERTHGFDSADFGHJGFDSADFGHFDSCDSFDSGVFVCXGVDFFDVFDVFDVDFDLocation: Erode, Tamil Nadu - Sathyamangalam, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |
Job Description: ydurtweytryewtrsdsgsgfhafydtqwueiqwueoiwquehcjzchdsgyfdstufywegufgdhfyuedgfuywegufygewucdhfghdsgfyedgfyegygrhyfgyrgtdfhdsgfjhsjdiwueiwjsdkanxzbchxvbhxcvLocation: Coimbatore, Tamil Nadu - Sathyamangalam, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Branch Credit Manager
Company: IDFC FIRST Bank |
laid out by the bank contributing to the larger organizational objectives of the bank. Roles & Responsibilities...-bank financial institutions and banks and the volume generated by them. Increasing the distribution channel by identifyingLocation: Theni, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Assistant Manager - Coding Auditor
Company: EXL Service |
. For more information, visit . EXL never requires or asks for fees/payments or credit card or bank details during any phase of theLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Manager - Corporate Employee Solutions-corporate Employee Solutions-regional Sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Manager in the Corporate EmployeeLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Rb-ls: Business Development Associate
Company: Axis Bank |
and retail forex business for the bank. The department drives business from branches across India and is responsible... to increase the retail book of the bank. About the Role Officer Sales are a part of the Bank's front-line sales forceLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Issue Remediation Analyst – C10
Company: Citigroup |
. Job responsibilities: R&R team manages the analysis of the customer remediation issues across globe, currently in retail consumer bankLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Senior Analyst - Credit Administration
Company: IDFC FIRST Bank |
Job Requirements Role/ Job Title: Analyst – Credit Administration Function/ Department: Wholesale Banking Operations Job Purpose 'Job requires to handle Post sanction activities in credit framewLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |
Job Description: dhgfhdsgfjshkAJLSKJ;lksalkxlaxmcnxnvjvbbxvbcxnvbcnbvncvmcnmbncbjfnjfnjkfjgsfiewjfejiqwuiqeiqwuehhhfhdsbjfbdsjvbjncbvjncbjvdfjbjvdbkjfvbnkjvnbm ncvm,nbmcvLocation: Tiruppur, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Sr. Assoc, Prod Specialist - Msd, Wrb Tech
Company: Standard Chartered |
and business conduct, across Standard Chartered Bank. This includes understanding and ensuring compliance with, in letter... bank, nimble enough to act, big enough for impact. For more than 170 years, we've worked to make a positive differenceLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Process Associate
Company: Apex Group |
broadest range of services in the industry including fund services, digital onboarding and bank accounts, depositary, custodyLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL SalesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager-saral Loans-marketing Branches Operations
Company: Kotak Mahindra Bank |
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a customer... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. EnhanceLocation: Namakkal, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Fraud Risk Analyst
Company: Equitas Small Finance Bank |
and govt, Bank employees etc) by Jun'25 & Quarterly revisions ( Minimum) Target Dec'25 Oubound call - Quality improvementLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL SalesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Director - Capital Markets Technology
Company: The Edge Partnership |
investment bank or major financial institution. You will demonstrate: 18+ years’ experience in Capital Markets TechnologyLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 10 Jul 2026
Relationship Manager
Company: Equitas Small Finance Bank |
-channel leads will also be given to the BDO for conversion. Purpose of the role To acquire New To Bank liability... relationships (Saving Accounts / Deposits) and strengthen existing relationships through highest levels of service quality Bank