find the right job for you in India


Bank jobs in tamil nadu state India

1,804 bank jobs found in tamil nadu state: showing 1 - 50

Relationship Manager
Company: Equitas Small Finance Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
-channel leads will also be given to the BDO for conversion. Purpose of the role To acquire New To Bank liability... relationships (Saving Accounts / Deposits) and strengthen existing relationships through highest levels of service quality Bank
Relationship Manager - Retail
Company: Equitas Small Finance Bank |

Location: Vellakoil, Tamil Nadu - Erode, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
from application to final approval and disbursement. Team Coordination: You act as the bridge between the customer and internal bank...: You ensure all submitted documents are real and valid to protect the bank from losing money. [ , , ]
Sh - Accounts Payable, Audit & Consolidation
Company: Aditya Birla Group |

Location: Gummidipoondi, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
outflow and prepare DFR To transfer funds based on requirement for payment and investment To prepare bank limits Vs... utilization on daily basis To open Letter of Credit & Bank Guarantee based on requirement from units. To prepare investment
Record To Report Ops Senior Analyst
Company: Accenture |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
asset","Amortization","Depreciation",Accruals","Finacial Consolidation","Account recon/ bank","Treasury","Finanacial
Relationship Manager - Retail
Company: Equitas Small Finance Bank |

Location: Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: DHFGWYETREWQYUWDHSAGDYWAGYDQWHDSDGYSAWGDYWAGDYWGASDYWGDYSAVDHGSAYDGWQYDGQWYUGQWYWDQWWQWSADEWDWDWDWQQEEQWESD
Solution Architect- Payments Domain
Company: Diverse Lynx |

Location: Hyderabad, Telangana - Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
flows knowledge and implementation experience of Swift Mandates, ISO 20022 Migration, Central bank mandates across major
Area Sales Manager-personal Loan-sales
Company: Kotak Mahindra Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree
Analyst, Data Strategy
Company: Standard Chartered |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
to productionise in collaboration with various teams People & Talent Lead through example and demonstrate the bank's culture... and business conduct, across Standard Chartered Bank. This includes understanding and ensuring compliance with, in letter
Relationship Manager-commercial Vehicle-marketing Branches Operations
Company: Kotak Mahindra Bank |

Location: Coimbatore, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a service... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. Enhance
Business Development Officer - Ucv
Company: Equitas Small Finance Bank |

Location: Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: Develop consistent pipeline of applications from good quality customers who require finance for purchase of New Commercial Vehicles through direct sourcing, Dealers, market referenc
Circle Manager - Hdfc Bank Branch Banking
Company: Tata AIA Life Insurance |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: Job description About Company: Tata AIA Life Insurance Company Limited (Tata AIA Life) is a joint venture company, formed by Tata Sons Pvt. Ltd. and AIA Group Ltd. (AIA). Tata A
Assistant Manager - Coding Auditor
Company: EXL Service |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
. For more information, visit . EXL never requires or asks for fees/payments or credit card or bank details during any phase of the
Relationship Manager-agri-fin-tractor Loans And Retail(tfe)-retail Sales
Company: Kotak Mahindra Bank |

Location: Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are seeking a dynamic and results
Rb-ls: Business Development Associate
Company: Axis Bank |

Location: Thanjavur, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
and retail forex business for the bank. The department drives business from branches across India and is responsible... to increase the retail book of the bank. About the Role Officer Sales are a part of the Bank's front-line sales force
Branch:teller
Company: Axis Bank |

Location: Thiruverumbur, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: About Branch Banking: The branches act as the face of Axis Bank for millions of retail customers... and is, hence, an integral part of the Bank’s strategy. Branches play a major role in deposit mobilization from New-To-Bank (NTB
Portfolio Relationship Manager - Wc-salaried Pl And Working Capital-sales
Company: Kotak Mahindra Bank |

Location: Coimbatore, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: Needs to have a good knowledge
Relationship Manager - Retail
Company: Equitas Small Finance Bank |

Location: Vellakoil, Tamil Nadu - Erode, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
from application to final approval and disbursement. Team Coordination: You act as the bridge between the customer and internal bank...: You ensure all submitted documents are real and valid to protect the bank from losing money. [ , , ]
Relationship Manager-comm Bankg-dealer Business Group-business Development
Company: Kotak Mahindra Bank |

Location: Salem, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Commercial Bank Degree Level: Bachelor's Degree
Relationship Manager - Mf
Company: Equitas Small Finance Bank |

Location: Erode, Tamil Nadu - Salem, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: adghweudgweydguyweduewydywegfdyuwegfuywgfuyewufgweyfgcuhdgfuyewgdedhgsdycgeydehdcyuedgfyefycygedquwhduhasgdysadu8sahdusgaydwydgwsydsd
Senior Executive – Ar Specialty
Company: EXL Service |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
or bank details during any phase of the recruitment or hiring process and has not authorized any agencies or partners
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |

Location: Sankari, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL Sales
Sap Ihc Functional Consultant
Company: Ford |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
: In-House Cash Accounts Payment advice processing Bank clearing and reconciliation Intercompany settlements Integrate IHC... and IHC (In-House Cash) configuration Good functional understanding of: Payment Orders & Internal Payments House Bank
Manager - Lec Controllers
Company: Standard Chartered |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
. Ensure that the periodic reconciliation & substantiation exercise across the bank is performed smoothly and escalate... are in place and being adhered to & to ensure a robust financial control environment in the Bank. Embed the Controllership
Relationship Manager - Mf
Company: Equitas Small Finance Bank |

Location: Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: fdfhjlkjhgfdsfghjkl;kjhgfdertyuiop;'l,mnbvcxzsdrtyuiopl;,mnbvcxzdstryuiop;'lkmjnbvcxzsaertyuiop[l;kjhgfcdxsawertyuiopl;kmnbvcxzsaertyuiopl;kjmnbvcxsdtfyguhjikl
Relationship Manager - Mf
Company: Equitas Small Finance Bank |

Location: Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: DGFAYTDQWETYDFWEYTDFWEYDFYSCVGSFDTYWEFDTYDHGSTYDEWYTDSGHDYSADYEWDHGYDTCEYDGEHGDYEGDYEFGDHDASJHIDYEWY7DEWYHDE
Relationship Manager-saral Loans-marketing Branches Operations
Company: Kotak Mahindra Bank |

Location: Sankari, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a customer... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. Enhance
Elite Banker-household-outbound-branch Banking-relationship Management
Company: Kotak Mahindra Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: We are seeking a dynamic... service while ensuring adherence to bank policies and compliance standards. Cross-sell a wide range of banking products
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |

Location: Tiruppur, Tamil Nadu - Perundurai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: adfbeshgfweyfdsjcdhfchakxbzhckjachdxzxcjnxcbkjxzncjdshudsczbcududchdgyedyshsdeysusd7gdydgyedtydgyfteywgdsw
Relationship Manager - Mf Collections
Company: Equitas Small Finance Bank |

Location: Chidambaram, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: sfdeufgsuydfgsuydfguydfhdbcydsgfyugfhfh cyugveuyffhbvuydfgfuydvhbcxvuygsduyfghvhcgvyxcbjcngzduyeaucxbuhdgfydcb hfguyffd
Assistant Manager - Coding Auditor
Company: EXL Service |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
requires or asks for fees/payments or credit card or bank details during any phase of the recruitment or hiring process
Senior Executive - Coding Auditor
Company: EXL Service |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
or bank details during any phase of the recruitment or hiring process and has not authorized any agencies or partners
Relationship Officer-811-digital Banking Kotak 811-sales
Company: Kotak Mahindra Bank |

Location: Salem, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Relationship Officer for Kotak..., and expanding the bank's digital footprint. Responsibilities: Conduct 100% field-based customer acquisition for Savings
Transformation Manger_culture & Capability, Director
Company: NatWest Group |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
bank’s strategic ambitions, shaping One Bank Capabilities (OBC) and customer and colleague journeys You’ll develop
Relationship Manager - Retail
Company: Equitas Small Finance Bank |

Location: Erode, Tamil Nadu - Sathyamangalam, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: SDFHSHDFGUEUQWIEOIWQWOPQIPOWIDVFFDHGFHFGHJGJHGJHYJHGJGFDFAEERTHGFDSADFGHJGFDSADFGHFDSCDSFDSGVFVCXGVDFFDVFDVFDVDFD
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |

Location: Coimbatore, Tamil Nadu - Sathyamangalam, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: ydurtweytryewtrsdsgsgfhafydtqwueiqwueoiwquehcjzchdsgyfdstufywegufgdhfyuedgfuywegufygewucdhfghdsgfyedgfyegygrhyfgyrgtdfhdsgfjhsjdiwueiwjsdkanxzbchxvbhxcv
Branch Credit Manager
Company: IDFC FIRST Bank |

Location: Theni, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
laid out by the bank contributing to the larger organizational objectives of the bank. Roles & Responsibilities...-bank financial institutions and banks and the volume generated by them. Increasing the distribution channel by identifying
Assistant Manager - Coding Auditor
Company: EXL Service |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
. For more information, visit . EXL never requires or asks for fees/payments or credit card or bank details during any phase of the
Manager - Corporate Employee Solutions-corporate Employee Solutions-regional Sales
Company: Kotak Mahindra Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Manager in the Corporate Employee
Rb-ls: Business Development Associate
Company: Axis Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
and retail forex business for the bank. The department drives business from branches across India and is responsible... to increase the retail book of the bank. About the Role Officer Sales are a part of the Bank's front-line sales force
Issue Remediation Analyst – C10
Company: Citigroup |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
. Job responsibilities: R&R team manages the analysis of the customer remediation issues across globe, currently in retail consumer bank
Senior Analyst - Credit Administration
Company: IDFC FIRST Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Requirements Role/ Job Title: Analyst – Credit Administration Function/ Department: Wholesale Banking Operations Job Purpose 'Job requires to handle Post sanction activities in credit framew
Relationship Manager - Ahf
Company: Equitas Small Finance Bank |

Location: Tiruppur, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Description: dhgfhdsgfjshkAJLSKJ;lksalkxlaxmcnxnvjvbbxvbcxnvbcnbvncvmcnmbncbjfnjfnjkfjgsfiewjfejiqwuiqeiqwuehhhfhdsbjfbdsjvbjncbvjncbjvdfjbjvdbkjfvbnkjvnbm ncvm,nbmcv
Sr. Assoc, Prod Specialist - Msd, Wrb Tech
Company: Standard Chartered |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
and business conduct, across Standard Chartered Bank. This includes understanding and ensuring compliance with, in letter... bank, nimble enough to act, big enough for impact. For more than 170 years, we've worked to make a positive difference
Process Associate
Company: Apex Group |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
broadest range of services in the industry including fund services, digital onboarding and bank accounts, depositary, custody
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL Sales
Relationship Manager-saral Loans-marketing Branches Operations
Company: Kotak Mahindra Bank |

Location: Namakkal, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Commercial Bank Degree Level: Bachelor's Degree Job Description: We are looking for a customer... like cheque book issuance. Achieve sales targets for bank and investment products through cross-selling and referrals. Enhance
Fraud Risk Analyst
Company: Equitas Small Finance Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
and govt, Bank employees etc) by Jun'25 & Quarterly revisions ( Minimum) Target Dec'25 Oubound call - Quality improvement
Acquisition Manager-sales-sales
Company: Kotak Mahindra Bank |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: The Acquisition Manager - RL Sales
Director - Capital Markets Technology
Company: The Edge Partnership |

Location: Chennai, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
investment bank or major financial institution. You will demonstrate: 18+ years’ experience in Capital Markets Technology
Relationship Manager
Company: Equitas Small Finance Bank |

Location: Chennai, Tamil Nadu - Sholinganallur, Tamil Nadu, India

| Salary: unspecified | Date posted: 10 Jul 2026
-channel leads will also be given to the BDO for conversion. Purpose of the role To acquire New To Bank liability... relationships (Saving Accounts / Deposits) and strengthen existing relationships through highest levels of service quality Bank