Manager jobs in tamil nadu state India
3,865 manager jobs found in tamil nadu state: showing 51 - 100
Branch Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: dsfgyusdtfywereiuwriqweqweqsdsahfdsgfsdgfhdsgfydsgfywqegywqeequishAJKSDHSDGSHFGHSDFVHDSVFSDHFHDSFYEWERSUGFHDSFGHDSFGSDHFGSDLocation: Erode, Tamil Nadu, India
| Salary: unspecified | Date posted: 08 Nov 2026
Analyst 1 - Revenue Assurance
Company: Xfinity |
or manager. Shares observations and suggestions that may improve resolution speed, data quality, operational efficiencyLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 08 Nov 2026
Ashvita's - Collections Manager
Company: Festivals From India |
The Art-X Company is hiring for their client Ashvita's in Chennai for a Collections Manager.... We are looking for an experienced and detail-oriented Collections Manager to lead the systematic management, documentation, conservation, and logisticalLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Lead Administrator L1
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Source Market Sales Manager (bengaluru/ Hyderabad)
Company: Pullman Hotels |
Company Description Pullman Chennai Anna Salai offers 232 stylish rooms, a swimming pool, fitness center, spa, two signature dining venues, versatile banquet spaces, boardrooms, and social lounges-iLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Developer L4
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro Digital |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... × Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Store Manager – Qsr Café Operations | Chai Waale | Chennai
Company: Praveza Consultancy |
Company Name: Chai Waale Job Title: Store Manager QSR Caf Operations Department: Store Operations Industry: Food... experience. Job Overview Chai Waale is looking for an energetic, responsible and result-oriented Store Manager to oversee theLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Assistant Manager - Operations - Operations - Cbs - Aws - Facilities&hospitality Svc - Chennai
Company: EY |
. The opportunity : Assistant Manager-Operations-Operations-CBS - AWS - Facilities&Hospitality Svc - Chennai OperationsLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager_prime Vishwaas -sales_salem
Company: Kotak Securities |
Job Category: Traditional Degree Level: Bachelor's DegreeLocation: Salem, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Sap Project Manager
Company: Acme Services |
Job Description: Lead and manage end-to-end SAP S/4HANA implementation projects. Own project planning, scope, schedule, milestones, resources and delivery. Define project plans, timelines, depenLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Ashvita's - Collections Manager
Company: Festivals From India |
The Art-X Company is hiring for their client Ashvita's in Chennai for a Collections Manager.... We are looking for an experienced and detail-oriented Collections Manager to lead the systematic management, documentation, conservation, and logisticalLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Senior Trade Relationship Manager_sales-retail Sales_coimbatore
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Senior Trade Relationship ManagerLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro Digital |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... × Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure RLocation: Nagapattinam, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Developer L4
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Axisphone:customer Service Team Lead - Non Voice
Company: Axis Bank |
to: AxisPhone:Service Head - Non Voice Is a Team leader? Yes Team Size: 15-20 Grade: Manager/Senior Manager Business: RetailLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Business Relationship Manager - Sbe_small Business Enterprise_0412_8514_1041920
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: To understand clients business & provide appropriate working capital solutions across Fund/ non Fund based products Location: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Developer L4
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Sourcing of LAP & Housing finance through connectors & self-sourcing. Empanelment of New connecters to source business in HF & LAP Process of LAP & Micro Location: Mannargudi, Tamil Nadu - Kumbakonam, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Senior Trade Relationship Manager_sales-retail Sales_tiruppur
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Senior Trade Relationship ManagerLocation: Tiruppur, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Lead Assistant Manager - Lead Software Engineer
Company: EXL Service |
Job Category: Product & Platforms Job Description: Candidate will be a part of the Advanced Analytics team within IMU - HLS and SGU - Domain Platforms contribute to analytics projects for Payers, Location: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Branch Manager - Gold Loan
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Sourcing of LAP & Housing finance through connectors & self-sourcing. Empanelment of New connecters to source business in HF & LAP Process of LAP & Micro Location: Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Mf Collections
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure RLocation: Kumbakonam, Tamil Nadu - Thanjavur, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager_vishwas_0412_8473_1016159_hrr
Company: Kotak Mahindra Bank |
Job Category: Consumer Bank Degree Level: Bachelor's DegreeLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Splunk Aiops With Immediate Joining
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro Digital |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... Manager When you visit any website, it may store or retrieve information on your browser, mostly in the form of cookiesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro Digital |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... Manager When you visit any website, it may store or retrieve information on your browser, mostly in the form of cookiesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure RLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Branch Manager-micro Business Loan
Company: IDFC FIRST Bank |
Job Requirements About the Role The Manager – Micro Business Loan is responsible for driving business loan businessLocation: Vellore, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Manager - Lv Sales - Vellore
Company: Schneider Electric |
Job Description: Lauritz Knudsen Electrical and Automation (A unit of Schneider Electric India Pvt. Ltd.) is a pioneering electrical and automation brand with a rich legacy of over 70 years in IndiaLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Key Accounts Manager
Company: MM Staffing & Career Consultants |
Roles and Responsibilities: Division : Criticure Strategic Account Management & Revenue Growth Account Strategy & Planning: Develop and execute long-term strategic account plans for high-value clLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Developer L4
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Debt Manager-flows-consumer Durable
Company: IDFC FIRST Bank |
Job Requirements About the Role The Collection Manager is responsible for planning, organizing, directingLocation: Tiruchirappalli, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Senior Trade Relationship Manager_sales-retail Sales_tiruppur
Company: Kotak Securities |
Job Category: Consumer Bank Degree Level: Bachelor's Degree Job Description: As a Senior Trade Relationship ManagerLocation: Tiruppur, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Mf Collections
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure RLocation: Kumbakonam, Tamil Nadu - Thanjavur, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Manager, Wccrr
Company: Standard Chartered |
Jobs Job Details Manager, WCCRR Job Description Requisition Number: 65374 Job Location: Chennai, IND Global Grade: Band 7 Work... website traffic. Consent to cookies from provider GoogleAnalytics Google Tag Manager Google Tag Manager is a tagLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Source Market Sales Manager (bengaluru/ Hyderabad)
Company: Accor |
Company Description Pullman Chennai Anna Salai offers 232 stylish rooms, a swimming pool, fitness center, spa, two signature dining venues, versatile banquet spaces, boardrooms, and social lounges-iLocation: Pullman, WA - Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Mf
Company: Equitas Small Finance Bank |
Job Description: Key Responsibilities: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure RLocation: Nagapattinam, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Mid Level Manager (mlm) L2
Company: Wipro Digital |
Jobs Job Description Apply now Start Please wait... Job Title: MID LEVEL MANAGER (MLM) L2 City: Chennai State/Province: Tamil Nadu Posting Start... Manager When you visit any website, it may store or retrieve information on your browser, mostly in the form of cookiesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro Digital |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... Manager When you visit any website, it may store or retrieve information on your browser, mostly in the form of cookiesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Manager - Grievance Management
Company: Equitas Small Finance Bank |
Job Description: Job Purpose To ensure timely and effective resolution of customer complaints and grievances while maintaining compliance with regulatory guidelines issued by the Reserve Bank of ILocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Ansible And Rhel With Immediate Joining
Company: Wipro Digital |
opportunities to all and values diversity. © 2026 Wipro Limited × Cookie Consent Manager When you visit any website, it mayLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: Achieve the defined Disbursement Targets for New Products Collection efficiency & Portfolio Quality Self Development Process OrientaitionLocation: Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Developer L4
Company: Wipro Digital |
× Cookie Consent Manager When you visit any website, it may store or retrieve information on your browser, mostly in the formLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Production Specialist L3
Company: Wipro Digital |
opportunities to all and values diversity. © 2026 Wipro Limited × Cookie Consent Manager When you visit any website, it mayLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Junior Executive - Program Management
Company: Flex |
, Coimbatore. Program Management vertical support Program Manager’s, by virtual customer focus team member to support programLocation: Coimbatore, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Technical Lead L1
Company: Wipro |
for a specific module under the guidance of the Project Manager, ensuring alignment with business requirements and technical... Manager When you visit any website, it may store or retrieve information on your browser, mostly in the form of cookiesLocation: Chennai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Area Sales Manager_new Car Finance-sales_madurai
Company: Kotak Securities |
Job Category: Traditional Degree Level: Bachelor's DegreeLocation: Madurai, Tamil Nadu, India
| Salary: unspecified | Date posted: 07 Nov 2026
Relationship Manager - Retail
Company: Equitas Small Finance Bank |
Job Description: Processing & generating leads for Micro LAP & Micro Housing finance by accessing their income through personal discussion & field Visit. Track and Ensure Repayments of the Loan di